CODE23 Peptides ®
LL-37
LL-37
A human cathelicidin-derived antimicrobial peptide supplied for in vitro investigation of innate immune signalling and membrane interactions in cultured cell and bacterial preparations. Strictly for laboratory research use only.
Strictly for laboratory research use only. Not for human or animal consumption.
Specifications
- Purity
- 99.0%
- Form
- Lyophilized powder
- Amount (per vial)
- 5 mg
- Storage
- Store lyophilized at -20°C, protected from light and moisture.
- Batch / Lot Number
- [LOT NUMBER]
Vial Size
Disclaimer: This product is strictly for laboratory and in vitro research purposes only. It is not approved for human consumption, veterinary use, diagnostic, or therapeutic applications.
Chemical Properties
- Sequence
- [LL-37, 37 aa]
- Molecular Formula
- C205H340N60O53
- Molecular Weight
- 4493.3 g/mol
- Appearance
- White lyophilized powder
Research Focus
A human cathelicidin-derived antimicrobial peptide supplied for in vitro investigation of innate immune signalling and membrane interactions in cultured cell and bacterial preparations. Strictly for laboratory research use only.
Common Questions